Showing 1 - 3 results out of 3 with the query:
AB_1853327
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TSKU antibody produced in rabbit
Human TSKU human
(Sigma-Aldrich Cat# HPA008164, RRID:AB_1853327)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA008164
Anti-TSKU antibody produced in rabbit
TSKU antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008164, RRID:AB_1853327)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; Western Blot; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA008164
Anti-TSKU polyclonal antibody Go To Vendor
TSKU epitope: DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA008164, RRID:AB_1853327)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008164