Showing 1 - 3 results out of 3 with the query:
AB_1853685
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MDH2 antibody produced in rabbit
Human MDH2 human
(Sigma-Aldrich Cat# HPA026720, RRID:AB_1853685)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA026720
Anti-MDH2 antibody produced in rabbit
MDH2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA026720, RRID:AB_1853685)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA026720
Anti-MDH2 antibody
MDH2 epitope: MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPE See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA026720, RRID:AB_1853685)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA026720