Showing 1 - 3 results out of 3 with the query:
AB_1853708
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MEA1 antibody produced in rabbit
Human MEA1 human
(Sigma-Aldrich Cat# HPA017921, RRID:AB_1853708)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017921
Anti-MEA1 antibody
MEA1 epitope: ALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQAS See NCBI gene human
(Atlas Antibodies Cat# HPA017921, RRID:AB_1853708)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA017921
Anti-MEA1 antibody produced in rabbit
MEA1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017921, RRID:AB_1853708)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017921