Showing 1 - 3 results out of 3 with the query:
AB_1853714
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MECR antibody produced in rabbit
Human MECR human
(Sigma-Aldrich Cat# HPA022018, RRID:AB_1853714)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA022018
Anti-MECR antibody produced in rabbit
MECR antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022018, RRID:AB_1853714)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA022018
Anti-MECR antibody Go To Vendor
MECR epitope: SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCV See NCBI gene human
(Atlas Antibodies Cat# HPA022018, RRID:AB_1853714)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022018