Showing 1 - 3 results out of 3 with the query:
AB_1853867
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-HSCB antibody produced in rabbit
Human HSCB human
(Sigma-Aldrich Cat# HPA018447, RRID:AB_1853867)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018447
Anti-HSCB antibody produced in rabbit
HSCB antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018447, RRID:AB_1853867)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA018447
Anti-HSCB polyclonal antibody Go To Vendor
HSCB epitope: QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK See NCBI gene human
(Atlas Antibodies Cat# HPA018447, RRID:AB_1853867)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018447