Showing 1 - 3 results out of 3 with the query:
AB_1853885
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-VSTM2A antibody produced in rabbit
Human VSTM2A human
(Sigma-Aldrich Cat# HPA021404, RRID:AB_1853885)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA021404
Anti-VSTM2A antibody produced in rabbit
VSTM2A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA021404, RRID:AB_1853885)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA021404
Anti-VSTM2A polyclonal antibody Go To Vendor
VSTM2A epitope: VSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGMETHFEPFILPLTNAPQKGQSYRVDRFMNG See NCBI gene human
(Atlas Antibodies Cat# HPA021404, RRID:AB_1853885)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA021404