Showing 1 - 3 results out of 3 with the query:
AB_1853916
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MGLL antibody produced in rabbit
Human MGLL human
(Sigma-Aldrich Cat# HPA011994, RRID:AB_1853916)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA011994
Anti-MGLL polyclonal antibody
MGLL epitope: RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM See NCBI gene human
(Atlas Antibodies Cat# HPA011994, RRID:AB_1853916)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA011994
Anti-MGLL antibody produced in rabbit
MGLL antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA011994, RRID:AB_1853916)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA011994