Showing 1 - 3 results out of 3 with the query:
AB_1854113
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MRPL41 antibody produced in rabbit
Human MRPL41 human
(Sigma-Aldrich Cat# HPA027160, RRID:AB_1854113)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA027160
Anti-MRPL41 polyclonal antibody Go To Vendor
MRPL41 epitope: GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL See NCBI gene human
(Atlas Antibodies Cat# HPA027160, RRID:AB_1854113)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA027160
Anti-MRPL41 antibody produced in rabbit
MRPL41 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA027160, RRID:AB_1854113)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA027160