Showing 1 - 3 results out of 3 with the query:
AB_1854367
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-NEK4 antibody produced in rabbit
Human NEK4 human
(Sigma-Aldrich Cat# HPA015750, RRID:AB_1854367)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA015750
Anti-NEK4 antibody produced in rabbit
NEK4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA015750, RRID:AB_1854367)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry; Immunofluorescence
rabbit
Sigma-Aldrich
HPA015750
Anti-NEK4 polyclonal antibody Go To Vendor
NEK4 epitope: VAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAGPGKPQEEDQP See NCBI gene human
(Atlas Antibodies Cat# HPA015750, RRID:AB_1854367)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA015750