Showing 1 - 3 results out of 3 with the query:
AB_1854710
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-NUP107 antibody produced in rabbit
Human NUP107 human
(Sigma-Aldrich Cat# HPA024141, RRID:AB_1854710)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA024141
Anti-NUP107 polyclonal antibody Go To Vendor
NUP107 epitope: HLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAP See NCBI gene human
(Atlas Antibodies Cat# HPA024141, RRID:AB_1854710)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAP; Manufacturer approved use: IHC
rabbit
Atlas Antibodies
HPA024141
Anti-NUP107 antibody produced in rabbit
NUP107 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA024141, RRID:AB_1854710)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA024141