Showing 1 - 3 results out of 3 with the query:
AB_1854719
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-NUP35 antibody produced in rabbit
Human NUP35 human
(Sigma-Aldrich Cat# HPA018401, RRID:AB_1854719)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018401
Anti-NUP35 antibody produced in rabbit
NUP35 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018401, RRID:AB_1854719)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA018401
Anti-NUP35 polyclonal antibody Go To Vendor
NUP35 epitope: DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID See NCBI gene human
(Atlas Antibodies Cat# HPA018401, RRID:AB_1854719)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018401