Showing 1 - 3 results out of 3 with the query:
AB_1854807
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ORAI3 antibody produced in rabbit
Human ORAI3 human
(Sigma-Aldrich Cat# HPA015022, RRID:AB_1854807)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA015022
Anti-ORAI3 antibody produced in rabbit
ORAI3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA015022, RRID:AB_1854807)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA015022
Anti-ORAI3 polyclonal antibody Go To Vendor
ORAI3 epitope: APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA See NCBI gene human
(Atlas Antibodies Cat# HPA015022, RRID:AB_1854807)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA015022