Showing 1 - 3 results out of 3 with the query:
AB_1854866
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CDKN2C antibody produced in rabbit
Human CDKN2C human
(Sigma-Aldrich Cat# HPA019764, RRID:AB_1854866)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA019764
Anti-CDKN2C antibody produced in rabbit
CDKN2C antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA019764, RRID:AB_1854866)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA019764
Anti-CDKN2C polyclonal antibody Go To Vendor
CDKN2C epitope: GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDT See NCBI gene human
(Atlas Antibodies Cat# HPA019764, RRID:AB_1854866)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDT; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies
HPA019764