Showing 1 - 3 results out of 3 with the query:
AB_1855083
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PCNXL3 antibody produced in rabbit
Human PCNXL3 human
(Sigma-Aldrich Cat# HPA018084, RRID:AB_1855083)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018084
Anti-PCNXL3 antibody produced in rabbit
PCNXL3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018084, RRID:AB_1855083)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA018084
Anti-PCNX3 antibody
PCNX3 epitope: LIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPLLKGSLSQELSKSFLTLTRPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDSCFS See NCBI gene human
(Atlas Antibodies Cat# HPA018084, RRID:AB_1855083)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA018084