Showing 1 - 3 results out of 3 with the query:
AB_1855124
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PDE5A antibody produced in rabbit
Human PDE5A human
(Sigma-Aldrich Cat# HPA012873, RRID:AB_1855124)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA012873
Anti-PDE5A antibody produced in rabbit
PDE5A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA012873, RRID:AB_1855124)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA012873
Anti-PDE5A polyclonal antibody
PDE5A epitope: GKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL See NCBI gene human
(Atlas Antibodies Cat# HPA012873, RRID:AB_1855124)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA012873