Showing 1 - 3 results out of 3 with the query:
AB_1855278
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PHC1 antibody produced in rabbit
Human PHC1 human
(Sigma-Aldrich Cat# HPA006973, RRID:AB_1855278)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA006973
Anti-PHC1 antibody produced in rabbit
PHC1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006973, RRID:AB_1855278)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA006973
Anti-PHC1 polyclonal antibody Go To Vendor
PHC1 epitope: LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS See NCBI gene human
(Atlas Antibodies Cat# HPA006973, RRID:AB_1855278)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006973