Showing 1 - 3 results out of 3 with the query:
AB_1855517
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-POGZ antibody produced in rabbit
Human POGZ human
(Sigma-Aldrich Cat# HPA008781, RRID:AB_1855517)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA008781
Anti-POGZ antibody produced in rabbit
POGZ antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008781, RRID:AB_1855517)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA008781
Anti-POGZ antibody Go To Vendor
POGZ epitope: PEELLTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASGGGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAEWV See NCBI gene human
(Atlas Antibodies Cat# HPA008781, RRID:AB_1855517)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008781