Showing 1 - 3 results out of 3 with the query:
AB_1855623
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PPM1E antibody produced in rabbit
Human PPM1E human
(Sigma-Aldrich Cat# HPA018462, RRID:AB_1855623)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018462
Anti-PPM1E antibody produced in rabbit
PPM1E antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018462, RRID:AB_1855623)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA018462
Anti-PPM1E polyclonal antibody Go To Vendor
PPM1E epitope: EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEI See NCBI gene human
(Atlas Antibodies Cat# HPA018462, RRID:AB_1855623)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018462