Showing 1 - 3 results out of 3 with the query:
AB_1856089
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RASGRF2 antibody produced in rabbit
Human RASGRF2 human
(Sigma-Aldrich Cat# HPA018679, RRID:AB_1856089)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018679
Anti-RASGRF2 polyclonal antibody Go To Vendor
RASGRF2 epitope: FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD See NCBI gene human
(Atlas Antibodies Cat# HPA018679, RRID:AB_1856089)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018679
Anti-RASGRF2 antibody produced in rabbit
RASGRF2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018679, RRID:AB_1856089)
polyclonal antibody
Vendor recommendations: Other; Immunofluorescence; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA018679