Showing 1 - 3 results out of 3 with the query:
AB_1856109
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RBM12B antibody produced in rabbit
Human RBM12B human
(Sigma-Aldrich Cat# HPA024398, RRID:AB_1856109)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA024398
Anti-RBM12B antibody produced in rabbit
RBM12B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA024398, RRID:AB_1856109)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA024398
Anti-RBM12B polyclonal antibody Go To Vendor
RBM12B epitope: NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK See NCBI gene human
(Atlas Antibodies Cat# HPA024398, RRID:AB_1856109)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA024398