Showing 1 - 3 results out of 3 with the query:
AB_1856125
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ESRP1 antibody produced in rabbit
Human ESRP1 human
(Sigma-Aldrich Cat# HPA023720, RRID:AB_1856125)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023720
Anti-ESRP1 antibody produced in rabbit
ESRP1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023720, RRID:AB_1856125)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA023720
Anti-ESRP1 polyclonal antibody Go To Vendor
ESRP1 epitope: QLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFES See NCBI gene human
(Atlas Antibodies Cat# HPA023720, RRID:AB_1856125)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFES; Manufacturer approved use: ICC-IF, IHC
rabbit
Atlas Antibodies
HPA023720