Showing 1 - 3 results out of 3 with the query:
AB_1856386
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RNMTL1 antibody produced in rabbit
Human RNMTL1 human
(Sigma-Aldrich Cat# HPA022534, RRID:AB_1856386)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA022534
Anti-RNMTL1 antibody produced in rabbit
RNMTL1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022534, RRID:AB_1856386)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA022534
Anti-MRM3 antibody Go To Vendor
MRM3 epitope: WDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFRE See NCBI gene human
(Atlas Antibodies Cat# HPA022534, RRID:AB_1856386)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022534