Showing 1 - 3 results out of 3 with the query:
AB_1856411
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RPA3 antibody produced in rabbit
Human RPA3 human
(Sigma-Aldrich Cat# HPA005708, RRID:AB_1856411)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA005708
Anti-RPA3 polyclonal antibody
RPA3 epitope: VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP See NCBI gene human
(Atlas Antibodies Cat# HPA005708, RRID:AB_1856411)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA005708
Anti-RPA3 antibody produced in rabbit
RPA3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA005708, RRID:AB_1856411)
polyclonal antibody
Vendor recommendations: Western Blot; Immunofluorescence; Other; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA005708