Showing 1 - 3 results out of 3 with the query:
AB_1856560
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-SAMSN1 antibody produced in rabbit
Human SAMSN1 human
(Sigma-Aldrich Cat# HPA017055, RRID:AB_1856560)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017055
Anti-SAMSN1 antibody produced in rabbit
SAMSN1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017055, RRID:AB_1856560)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017055
Anti-SAMSN1 antibody Go To Vendor
SAMSN1 epitope: LLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS See NCBI gene human
(Atlas Antibodies Cat# HPA017055, RRID:AB_1856560)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017055