Showing 1 - 3 results out of 3 with the query:
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Host Organism
Cat Num
Anti-SPIB antibody produced in rabbit
Human SPIB human
(Sigma-Aldrich Cat# HPA018523, RRID:AB_1857443)
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-SPIB polyclonal antibody
SPIB See NCBI gene human
(Atlas Antibodies Cat# HPA018523, RRID:AB_1857443)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDEALVA; Manufacturer approved use: IHC
Atlas Antibodies Go To Vendor
Anti-SPIB antibody produced in rabbit
SPIB antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018523, RRID:AB_1857443)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other