Showing 1 - 3 results out of 3 with the query:
AB_1857863
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CD247 antibody produced in rabbit
Human CD247 human
(Sigma-Aldrich Cat# HPA008750, RRID:AB_1857863)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA008750
Anti-CD247 antibody produced in rabbit
CD247 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008750, RRID:AB_1857863)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA008750
Anti-CD247 polyclonal antibody Go To Vendor
CD247 epitope: KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP See NCBI gene human
(Atlas Antibodies Cat# HPA008750, RRID:AB_1857863)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008750