Showing 1 - 3 results out of 3 with the query:
AB_1858027
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TLK1 antibody produced in rabbit
Human TLK1 human
(Sigma-Aldrich Cat# HPA016043, RRID:AB_1858027)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA016043
Anti-TLK1 antibody Go To Vendor
TLK1 epitope: ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKL See NCBI gene human
(Atlas Antibodies Cat# HPA016043, RRID:AB_1858027)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA016043
Anti-TLK1 antibody produced in rabbit
TLK1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA016043, RRID:AB_1858027)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA016043