Showing 1 - 3 results out of 3 with the query:
AB_1858112
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TMEM25 antibody produced in rabbit
Human TMEM25 human
(Sigma-Aldrich Cat# HPA012163, RRID:AB_1858112)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA012163
Anti-TMEM25 antibody produced in rabbit
TMEM25 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA012163, RRID:AB_1858112)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA012163
Anti-TMEM25 polyclonal antibody
TMEM25 epitope: RKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEI See NCBI gene human
(Atlas Antibodies Cat# HPA012163, RRID:AB_1858112)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA012163