Showing 1 - 3 results out of 3 with the query:
AB_1858312
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TRIM59 antibody produced in rabbit
Human TRIM59 human
(Sigma-Aldrich Cat# HPA017750, RRID:AB_1858312)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017750
Anti-TRIM59 antibody produced in rabbit
TRIM59 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017750, RRID:AB_1858312)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA017750
Anti-TRIM59 polyclonal antibody Go To Vendor
TRIM59 epitope: MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLL See NCBI gene human
(Atlas Antibodies Cat# HPA017750, RRID:AB_1858312)
polyclonal antibody
Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017750