Showing 1 - 3 results out of 3 with the query:
AB_1859058
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ZFPM2-human antibody Go To Vendor
ZFPM2 homo sapiens
(Sigma-Aldrich Cat# HPA004094, RRID:AB_1859058)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot A69461 for any cell type or tissues; status is awaiting lab characterization
rabbit
Sigma-Aldrich
HPA004094
Anti-ZFPM2 antibody produced in rabbit
ZFPM2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004094, RRID:AB_1859058)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; protein array: suitable, : suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA004094
Anti-ZFPM2 polyclonal antibody Go To Vendor
ZFPM2 epitope: CLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQSERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQ See NCBI gene human
(Atlas Antibodies Cat# HPA004094, RRID:AB_1859058)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004094