Showing 1 - 3 results out of 3 with the query:
AB_1859124
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ZNF207-human antibody Go To Vendor
ZNF207 homo sapiens
(Sigma-Aldrich Cat# HPA017013, RRID:AB_1859124)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot A82699 for K562,HepG2,liver,HeLa-S3,MCF-7,GM12878; status is awaiting lab characterization,not eligible for new data
rabbit
Sigma-Aldrich
HPA017013
Anti-ZNF207 antibody Go To Vendor
ZNF207 epitope: KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA017013, RRID:AB_1859124)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017013
Anti-ZNF207 antibody produced in rabbit
ZNF207 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017013, RRID:AB_1859124)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA017013