Showing 1 - 3 results out of 3 with the query:
AB_1859140
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ZNF23-human antibody Go To Vendor
ZNF23 homo sapiens
(Sigma-Aldrich Cat# HPA023534, RRID:AB_1859140)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R10286 for any cell type or tissues; status is awaiting lab characterization
rabbit
Sigma-Aldrich
HPA023534
Anti-ZNF23 antibody produced in rabbit
ZNF23 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023534, RRID:AB_1859140)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA023534
Anti-ZNF23 antibody Go To Vendor
ZNF23 epitope: KSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECG See NCBI gene human
(Atlas Antibodies Cat# HPA023534, RRID:AB_1859140)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA023534