Showing 1 - 3 results out of 3 with the query:
AB_1859195
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ZNF324B antibody produced in rabbit
Human ZNF324B human
(Sigma-Aldrich Cat# HPA023400, RRID:AB_1859195)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023400
Anti-ZNF324B polyclonal antibody Go To Vendor
ZNF324B epitope: KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV See NCBI gene human
(Atlas Antibodies Cat# HPA023400, RRID:AB_1859195)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA023400
Anti-ZNF324B antibody produced in rabbit
ZNF324B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023400, RRID:AB_1859195)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA023400