Showing 1 - 3 results out of 3 with the query:
AB_1859465
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ZNF830 antibody produced in rabbit
Human ZNF830 human
(Sigma-Aldrich Cat# HPA027211, RRID:AB_1859465)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA027211
Anti-ZNF830 antibody Go To Vendor
ZNF830 epitope: GSSASSAPQSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGKEFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGER See NCBI gene human
(Atlas Antibodies Cat# HPA027211, RRID:AB_1859465)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA027211
Anti-ZNF830 antibody produced in rabbit
ZNF830 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA027211, RRID:AB_1859465)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA027211