Showing 1 - 4 results out of 4 with the query:
AB_2211524
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TTC13 antibody produced in rabbit
TTC13 human
(Sigma-Aldrich Cat# HPA018022, RRID:AB_2211524)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018022
Anti-TTC13 antibody produced in rabbit
TTC13 See NCBI gene human
(Sigma-Aldrich Cat# HPA018022, RRID:AB_2211524)
polyclonal antibody
Useful for immunohistochemistry
rabbit
Sigma-Aldrich
HPA018022
Anti-TTC13 antibody produced in rabbit
TTC13 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018022, RRID:AB_2211524)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA018022
Anti-TTC13 polyclonal antibody Go To Vendor
TTC13 epitope: EERTQLYHAEIDALYKDLTAKGKVLILSSEFGEADAVCNLILSLVYYFYNLMPLSRGSSVIAYSVIVGALMASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAKSWMNLKSISPSYKTLPSVSETFPTLRSMIEVLNTDSSPRCL See NCBI gene human
(Atlas Antibodies Cat# HPA018022, RRID:AB_2211524)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018022