Showing 1 - 4 results out of 4 with the query:
AB_2244190
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CCDC120 antibody produced in rabbit
CCDC120 human
(Sigma-Aldrich Cat# HPA000561, RRID:AB_2244190)
polyclonal antibody
Useful for western blot, immunohistochemistry, protein array
rabbit
Sigma-Aldrich
HPA000561
Anti-CCDC120 antibody produced in rabbit
CCDC120 human
(Sigma-Aldrich Cat# HPA000561, RRID:AB_2244190)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA000561
Anti-CCDC120 polyclonal antibody
CCDC120 epitope: QADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVVLHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQLR See NCBI gene human
(Atlas Antibodies Cat# HPA000561, RRID:AB_2244190)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVVLHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQLR; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies Go To Vendor
HPA000561
Anti-CCDC120 antibody produced in rabbit
CCDC120 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000561, RRID:AB_2244190)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA000561