Showing 1 - 4 results out of 4 with the query:
AB_2245776
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CXorf61 antibody produced in rabbit
CXorf61 See NCBI gene human
(Sigma-Aldrich Cat# HPA004773, RRID:AB_2245776)
polyclonal antibody
Useful for immunohistochemistry, protein array
rabbit
Sigma-Aldrich
HPA004773
Anti-CXorf61 antibody produced in rabbit
CXorf61 human
(Sigma-Aldrich Cat# HPA004773, RRID:AB_2245776)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA004773
Anti-CXorf61 antibody produced in rabbit
CXorf61 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004773, RRID:AB_2245776)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA004773
Anti-CT83 polyclonal antibody Go To Vendor
CT83 epitope: QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST See NCBI gene human
(Atlas Antibodies Cat# HPA004773, RRID:AB_2245776)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004773