Showing 1 - 4 results out of 4 with the query:
AB_2257412
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ZC3HAV1L antibody produced in rabbit
ZC3HAV1L See NCBI gene human
(Sigma-Aldrich Cat# HPA020386, RRID:AB_2257412)
polyclonal antibody
Useful for immunohistochemistry
rabbit
Sigma-Aldrich
HPA020386
Anti-ZC3HAV1L antibody produced in rabbit
ZC3HAV1L human
(Sigma-Aldrich Cat# HPA020386, RRID:AB_2257412)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA020386
Anti-ZC3HAV1L polyclonal antibody Go To Vendor
ZC3HAV1L epitope: CKRSHQLIHAASLKLLQDQGLNIPSVVNFQIISTYKHMKLHKMLENTDNSSPSTEHSQGLEKQGVHAAGAAEAGPLASVPAQSAKKPCPV See NCBI gene human
(Atlas Antibodies Cat# HPA020386, RRID:AB_2257412)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA020386
Anti-ZC3HAV1L antibody produced in rabbit
ZC3HAV1L antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA020386, RRID:AB_2257412)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA020386