Showing 1 - 4 results out of 4 with the query:
AB_2268411
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PNPLA7 antibody produced in rabbit
PNPLA7 See NCBI gene human
(Sigma-Aldrich Cat# HPA009130, RRID:AB_2268411)
polyclonal antibody
Useful for western blot, immunohistochemistry, protein array
rabbit
Sigma-Aldrich
HPA009130
Anti-PNPLA7 antibody produced in rabbit
PNPLA7 human
(Sigma-Aldrich Cat# HPA009130, RRID:AB_2268411)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA009130
Anti-PNPLA7 antibody produced in rabbit
PNPLA7 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA009130, RRID:AB_2268411)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA009130
Anti-PNPLA7 polyclonal antibody Go To Vendor
PNPLA7 epitope: CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE See NCBI gene human
(Atlas Antibodies Cat# HPA009130, RRID:AB_2268411)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA009130