Showing 1 - 4 results out of 4 with the query:
AB_2294503
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GALNT8 antibody produced in rabbit
GALNT8 See NCBI gene human
(Sigma-Aldrich Cat# HPA012638, RRID:AB_2294503)
polyclonal antibody
Useful for immunohistochemistry
rabbit
Sigma-Aldrich
HPA012638
Anti-GALNT8 antibody produced in rabbit
GALNT8 human
(Sigma-Aldrich Cat# HPA012638, RRID:AB_2294503)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA012638
Anti-GALNT8 polyclonal antibody Go To Vendor
GALNT8 epitope: NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVR See NCBI gene human
(Atlas Antibodies Cat# HPA012638, RRID:AB_2294503)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA012638
Anti-GALNT8 antibody produced in rabbit
GALNT8 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA012638, RRID:AB_2294503)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA012638