Showing 1 - 2 results out of 2 with the query:
AB_2667295
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ASNS antibody Go To Vendor
ASNS epitope: QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP See NCBI gene human
(Atlas Antibodies Cat# HPA004924, RRID:AB_2667295)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004924
Anti-ASNS antibody
ASNS human
(Sigma-Aldrich Cat# HPA004924, RRID:AB_2667295)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA004924