Showing 1 - 2 results out of 2 with the query:
AB_2668094
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ITGA3 antibody Go To Vendor
ITGA3 epitope: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV See NCBI gene human, rat
(Atlas Antibodies Cat# HPA008572, RRID:AB_2668094)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008572
Anti-ITGA3 antibody
ITGA3 human, rat
(Sigma-Aldrich Cat# HPA008572, RRID:AB_2668094)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA008572