Showing 1 - 2 results out of 2 with the query:
AB_2668565
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TSPAN1 antibody Go To Vendor
TSPAN1 epitope: TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV See NCBI gene human
(Atlas Antibodies Cat# HPA011909, RRID:AB_2668565)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA011909
Anti-TSPAN1 antibody
TSPAN1 human
(Sigma-Aldrich Cat# HPA011909, RRID:AB_2668565)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA011909