Showing 1 - 2 results out of 2 with the query:
AB_2675737
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-AAMDC antibody Go To Vendor
AAMDC epitope: EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK See NCBI gene human
(Atlas Antibodies Cat# HPA037918, RRID:AB_2675737)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA037918
Anti-AAMDC antibody
AAMDC human
(Sigma-Aldrich Cat# HPA037918, RRID:AB_2675737)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA037918