Showing 1 - 1 results out of 1 with the query:
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Host Organism
Cat Num
Anti-ACCSL polyclonal antibody Go To Vendor
(Atlas Antibodies Cat# HPA046163, RRID:AB_2679566)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSRQGLSLEERRHTEAICEHEALLSRLICRMINLLQSG; Manufacturer approved use: IHC
Atlas Antibodies