Showing 1 - 1 results out of 1 with the query:
AB_2681592
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ANKRD20A4 polyclonal antibody Go To Vendor
ANKRD20A4 epitope: ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS See NCBI gene human
(Atlas Antibodies Cat# HPA051753, RRID:AB_2681592)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA051753