Showing 1 - 2 results out of 2 with the query:
AB_2682376
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-NONO antibody Go To Vendor
NONO epitope: EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG See NCBI gene human
(Atlas Antibodies Cat# HPA054094, RRID:AB_2682376)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA054094
Anti-NONO antibody
NONO human
(Sigma-Aldrich Cat# HPA054094, RRID:AB_2682376)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA054094