Showing 1 - 1 results out of 1 with the query:
AB_2686548
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-YTHDC2 polyclonal antibody Go To Vendor
YTHDC2 epitope: TVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHKDIDAFAQVFHLILTENVSVDYRHSETSATA See NCBI gene human
(Atlas Antibodies Cat# HPA072678, RRID:AB_2686548)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA072678