Showing 1 - 2 results out of 2 with the query:
AB_2732388
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TBR1 antibody Go To Vendor
TBR1 epitope: LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG See NCBI gene human
(Atlas Antibodies Cat# HPA078657, RRID:AB_2732388)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA078657
Anti-TBR1 antibody
TBR1 human
(Sigma-Aldrich Cat# HPA078657, RRID:AB_2732388)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA078657