Showing 1 - 1 results out of 1 with the query:
AB_2827844
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Epidermal Growth Factor Receptor antibody Go To Vendor
EGFR epitope: aa 1069-1099: (pY)SSDPTGALTEDSIDDTFLPVPEYINQSVPK See NCBI gene human
(DSHB Cat# CPTC-EGFR-11, RRID:AB_2827844)
monoclonal antibody
CPTC-EGFR-11
rabbit
DSHB
CPTC-EGFR-11